PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0076s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 295aa    MW: 33790.1 Da    PI: 7.46
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0076s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.8e-51241512128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                              pGfrFhPtdeelv +yL++kve+k+ ++ e+ik++diyk++PwdLpk+ + ++kewyfF+ r +ky+++ r+nr+t+sg+Wkatg 
  SapurV1A.0076s0070.1.p  24 LPGFRFHPTDEELVGFYLRRKVEKKPSSI-EIIKQIDIYKYDPWDLPKASTVGDKEWYFFCIRGRKYRNSVRPNRVTRSGFWKATGI 109
                             59************************999.89***************888889********************************** PP

                     NAM  89 dkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             dk+++s   ++e +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  SapurV1A.0076s0070.1.p 110 DKPIYSFkeTHECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 151
                             *****97445566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5515180IPR003441NAC domain
PROSITE profilePS5100552.97723181IPR003441NAC domain
PfamPF023658.5E-2625151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MEAVTGMSGC ISSENYNKEK EERLPGFRFH PTDEELVGFY LRRKVEKKPS SIEIIKQIDI  60
YKYDPWDLPK ASTVGDKEWY FFCIRGRKYR NSVRPNRVTR SGFWKATGID KPIYSFKETH  120
ECIGLKKSLV YYRGSAGKGT KTDWMMHEFR LPPDGKTTNP FSPMNIAQEA EVWTLCRILK  180
RIPSYKKNVP AVPATEKTPI NRDHSNLKTC SSFESETSTE QKPAIVDPVD HGKNHVFMGA  240
QNDSETEAPS TADYQGFWNP GTGDDFFVNR NWDDLATVVE LAIDPAQVYD ECRW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-462518719171NAC domain-containing protein 19
4dul_A1e-462518719171NAC domain-containing protein 19
1ut7_B1e-462518719171NO APICAL MERISTEM PROTEIN
1ut7_A1e-462518719171NO APICAL MERISTEM PROTEIN
1ut4_B1e-462518719171NO APICAL MERISTEM PROTEIN
1ut4_A1e-462518719171NO APICAL MERISTEM PROTEIN
3swp_D1e-462518722174NAC domain-containing protein 19
3swp_C1e-462518722174NAC domain-containing protein 19
3swp_B1e-462518722174NAC domain-containing protein 19
3swp_A1e-462518722174NAC domain-containing protein 19
3swm_D1e-462518722174NAC domain-containing protein 19
3swm_C1e-462518722174NAC domain-containing protein 19
3swm_B1e-462518722174NAC domain-containing protein 19
3swm_A1e-462518722174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307563.11e-170hypothetical protein POPTR_0005s22710g
SwissprotQ9SK551e-93NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLB9H8451e-170B9H845_POPTR; Uncharacterized protein
STRINGPOPTR_0005s22710.11e-170(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.16e-92NAC domain containing protein 42